PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Vang0071ss00600.3
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Vigna
Family MYB_related
Protein Properties Length: 112aa    MW: 12950.1 Da    PI: 10.147
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Vang0071ss00600.3genomeSNUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding49.59.7e-161461148
                       TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
    Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                       +g+WT+ Ed++l ++++ +G g W+  +++ g++R++k+c++rw++yl
  Vang0071ss00600.3 14 KGAWTALEDKILTEYINVHGEGKWRHLPKRAGLKRCGKSCRLRWLNYL 61
                       79*********************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.608.3E-23564IPR009057Homeodomain-like
PROSITE profilePS5129421.316965IPR017930Myb domain
SMARTSM007171.8E-121363IPR001005SANT/Myb domain
PfamPF002492.3E-141461IPR001005SANT/Myb domain
SuperFamilySSF466899.8E-221590IPR009057Homeodomain-like
CDDcd001672.71E-91661No hitNo description
Gene3DG3DSA:1.10.10.605.6E-86589IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 112 aa     Download sequence    Send to blast
MGRSPCCSKE GLNKGAWTAL EDKILTEYIN VHGEGKWRHL PKRAGLKRCG KSCRLRWLNY  60
LRPGIKRGNI TNDEEELIIR LHNLLGNRYI YRHYSTCFSV FLLIITNFLS L*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C8e-14128925101MYB TRANSFORMING PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150421e-112AP015042.1 Vigna angularis var. angularis DNA, chromosome 9, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_014515267.12e-58PREDICTED: myb-related protein 308-like
SwissprotP102901e-43MYBC_MAIZE; Anthocyanin regulatory C1 protein
TrEMBLA0A0L9T6S24e-59A0A0L9T6S2_PHAAN; Uncharacterized protein
STRINGGLYMA16G00931.17e-56(Glycine max)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G16720.13e-43myb domain protein 7